dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

WP_011061817.1.6225 (NCBI 2017_08 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment MULTISPECIES: carboxynorspermidine decarboxylase [Pseudomonas]; AA=GCF_900119635.1; RF=na; TAX=1566206; STAX=1566206; NAME=Pseudomonas sp. NFPP14; strain=NFPP14; AL=Scaffold; RT=Major
Sequence length 365
Sequence
MIKTPYYLIDKQKLLSNMQKIAYVREQSGAKALLALKCFATWSVFDLMQQYMDGTTSSSL
YELKLGRQKFEGETHAYSVAWADDEIEEMLANCDKIIFNSISQLQRFADASAGKVRGLRV
NPQVSSSDYLLADPARPFSRLGEWDPAKIEQVIEQISGFMFHNNCENGDFGLFDQMLTTI
EERFGHLLHKVEWVSLGGGIHFTGEDYALDAFCARLKAFSQKYGVQVYLEPGEAAITQSA
SLEVTVLDTLYNGKHLAVVDSSIEAHMLDLLIYRLNAKLSPSAGEHTYMVCGKSCLAGDI
FGEYQFDRPLAIGDRLSFIDAAGYTMVKKNWFNGLKMPSIVVKQLDGSIEVVREFGFEDY
LSSLS

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]