dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

WP_011080669.1.94371 (NCBI 2017_08 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment MULTISPECIES: 16S rRNA pseudouridine(516) synthase [Vibrio]; AA=GCF_001890655.1; RF=na; TAX=676; STAX=676; NAME=Vibrio fluvialis; strain=NCTC 11327; AL=Scaffold; RT=Major
Sequence length 233
Sequence
MRLDKFLCDALGATRKEATKILKSGEVTVNEQVQKSGAVKVTEECVVEWQGRELAMQGPR
YIMLYKPEGFVCSHEDGFNHTAFVLLDEVKMDELHFAGRLDVDTTGLVLITDDGKWSHRI
TSPKHKCDKTYRVWLADPIGSDYAEKLAEGVQLRNEKELTLPAQMTIVNADENEVLLTIH
EGKYHQVKRMFAALGNKVEQLHRERIGAIELDESLEPGEYRYLTQEEIDSVWK

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]