dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

WP_011103017.1.17870 (NCBI 2017_08 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment sodium-independent anion transporter [Pseudomonas syringae group genomosp. 3]; AA=GCF_000980905.1; RF=na; TAX=237306; STAX=251701; NAME=Pseudomonas syringae pv. persicae; strain=NCPPB 2254; AL=Contig; RT=Major
Sequence length 522
Sequence
MRWLNRHKFLPFLAWLPQQSRASVGRDALVGLSGAILALPQSIAYALIAGLPPEYGLYAA
IVPVLIACLWGSSWHLICGPTAAISIVLYVSVSPLAVPASQDYIMLILLLTFIAGVFQLL
LGMMRFGALVNFVSHSVVLGFTLGAAVVIALGQMPNLLGIDLPSQTTALKSLSAVLEHRG
ELDKPSLMLGLLTLTLGIGLKAWVPRWPTLLIALVSSSLLVWLWPAMFGHVRVVSAFVGH
LPPFSPLPLDLELILKLLPTAVAVGMLGLVNSLSIARSLSARSQQMLNANQEVRAQGLSN
MVGSLFSGYLSAGSFTRAALSYEAGARSPLAGVFSALWVALFAVAGASLVSHIPIPAMAA
SILLICWGLVDRRGIRALLRVSRAEFFVMALTCLATLLLELQTAIYAGVLASLFFYLKRT
SQPRVQQWREGDEDVLRVGGSIFFGASHYLQTRLQRTEGLRVVIDAQQINFIDYSGVEML
HQEARRLGQQGRVLVLRNARPLVIEELHKLEGPENCPILFED

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]