dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

WP_011112397.1.61914 (NCBI 2017_08 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment chemotaxis response regulator protein-glutamate methylesterase [Nitrosomonas europaea]; AA=GCF_900111725.1; RF=na; TAX=915; STAX=915; NAME=Nitrosomonas europaea; strain=Nm35; AL=Contig; RT=Major
Sequence length 358
Sequence
MKKISVLIIDDSALIRKLLTEIINARPDMEVIGAAPDPIVAREMIRTLNPDVLTLDVEMP
KMDGLEFLEKLMRLRPMPVVMVSTLTERGSEVTFRALELGAVDFVAKPKMDIRNSLEAYT
DEITGKIRTASTARIHRLEPVASNGAASGSIVQMPRHHGISTEKLIIIGASTGGTEAIKD
VLIHLPPDCPGILITQHMPEGFTRSFAERLDRLCKIRVKEAEGGERVLPGHAYLAPGHSH
LLLKKSGANYVTELSQTDPVNRHRPSVDVLFQSAAHCAGKNAVGVILTGMGKDGAAGMLD
MHHAGAYNLAQDETSCVVFGMPKEAITLGAVDEIVPLQDMARRILARLVGAGKQAVRV

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]