dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

WP_011149934.1.58885 (NCBI 2017_08 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment 23S rRNA pseudouridylate synthase B [Vibrio vulnificus]; AA=GCF_000746665.1; RF=na; TAX=672; STAX=672; NAME=Vibrio vulnificus; strain=93U204; AL=Complete Genome; RT=Major
Sequence length 320
Sequence
MNEKLQKVLARAGHGSRRELEALIKSGRVSVNGIVAKLGERLEDEQAVVRIDGHVVSVKA
QEEVICRVLAYYKPEGELCTRHDPEGRRTVFDRLPKIRGSRWISVGRLDANTSGLLLFTT
DGELANRLMHPSRQVEREYLVRVFGEVNEHKVRNLVNGVELDDGLARFEDVVYTGGEGMN
HTFYVVINEGRNREVRRLWESQDCTVSRLKRVRYGDIYLDKKLPRGGWMELELKDVNYLR
ELVELRPEKETMIELNNSSRKRDRARSQKIRRAVKRHEERVSTPKGRSNNAARRKPSKAA
GQTSKTNSRNQAGSRSKPQR

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]