dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

WP_011149934.1.79678 (NCBI 2017_08 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment 23S rRNA pseudouridylate synthase B [Vibrio vulnificus]; AA=GCF_001013325.1; RF=na; TAX=1112911; STAX=672; NAME=Vibrio vulnificus CladeA-yb158; strain=CladeA-yb158; AL=Contig; RT=Major
Sequence length 320
Sequence
MNEKLQKVLARAGHGSRRELEALIKSGRVSVNGIVAKLGERLEDEQAVVRIDGHVVSVKA
QEEVICRVLAYYKPEGELCTRHDPEGRRTVFDRLPKIRGSRWISVGRLDANTSGLLLFTT
DGELANRLMHPSRQVEREYLVRVFGEVNEHKVRNLVNGVELDDGLARFEDVVYTGGEGMN
HTFYVVINEGRNREVRRLWESQDCTVSRLKRVRYGDIYLDKKLPRGGWMELELKDVNYLR
ELVELRPEKETMIELNNSSRKRDRARSQKIRRAVKRHEERVSTPKGRSNNAARRKPSKAA
GQTSKTNSRNQAGSRSKPQR

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]