dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

WP_011150966.1.25536 (NCBI 2017_08 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment tRNA pseudouridine(65) synthase TruC [Vibrio vulnificus]; AA=GCF_001471415.1; RF=na; TAX=672; STAX=672; NAME=Vibrio vulnificus; strain=ATCC 29306; AL=Contig; RT=Major
Sequence length 245
Sequence
MLEIVYQDEYFVAVNKPAGMLVHRSWLDKHETQFVMQTLRDQIGQHVFPLHRLDRPTSGV
LVFALSSEVASQVMPMFAGQEMSKTYHAIVRGWIEEEGELDYALKVELDKIADKFASQEK
EAQDAITLYKPLAKVEVPYSTGKFPTTRYGLMELKPKTGRKHQLRRHMAHLRHPIVGDTT
HGDGKHNKLFREEFEAPRLLLHASELRFVHPYTQQEVVIRAEVDKVWQQLFERFEWPSTL
LTASH

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]