dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

WP_011152654.1.34622 (NCBI 2017_08 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment elongation factor G [Vibrio vulnificus]; AA=GCF_000009745.1; RF=na; TAX=196600; STAX=672; NAME=Vibrio vulnificus YJ016; strain=YJ016; AL=Complete Genome; RT=Major
Sequence length 672
Sequence
MPINKIRNIAFVGQSGSGKTTLIEKLLFACDATTHLGSIEKGDTVTDFDDQSIQYQHSIE
ATPVALSWQKHRLNIIDTPGLSELLGRSLSVFPAVETSVLVLDPQMPLTQVTDKLFQFAQ
QQKKCQMIIINKLDNHGNQLEKLLDEIQDHFGSNCLPINLPSADGNEVVDCFFEPQYQQA
TLLSSVEATHETLIDQVVEVDEELMELYLEQGSELTPAQLHDPFEEALRTGHVVPICFAS
AQTGAGIELLLRTLAELMPMPNEGNPPLLQKNGKMIKVNCDTLEHTVAHVYKISVDPYMG
KLAYLRVFQGEINAGSQLYVGESNKAFKVGHLYQLQGKQRTEISRALAGDFCVLAKVDEL
EFDSIVHDSHDEDDVSLKTLHFPQPMYSLSLKPTKRGDEQKLGEVLNRIVSEDPSLRLEH
RARTNETILSGQGEFHLKIALEKMASVYKLEVDTEQPSVEYFETITKPAEGQYRHKKQSG
GAGQFGEVHLSVKPLERGAGFKFVNKVVGGAIPTSLIPAVEKGIHQALEEGAISNNPIRD
IEVTVHDGKYHSVDSKEIAFVIAGKKAFLDAVKKADPIVLEPIVQLELTIPTSNVGDVTG
DLSGNRGLIEGTEPQANNLTLIKGKSPLNELQDYARKLRALTGGEGSFNMSLSHYEPAPP
AVQKRVCEETTS

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]