dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

WP_011161544.1.27409 (NCBI 2017_08 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment accessory Sec system protein Asp1 [Lactobacillus johnsonii]; AA=GCF_000008065.1; RF=na; TAX=257314; STAX=33959; NAME=Lactobacillus johnsonii NCC 533; strain=NCC 533; AL=Complete Genome; RT=Major
Sequence length 502
Sequence
MKYFIPAWHKQYDDWSINIPSIENYDAAEYMTVLKKFDEEIGLIITDYQSQLLSKLNQIA
FFPNTLFSVYDFLQGVHGFENKVLELEDFNWPKNAIFDYGPFRTLIVLENKLYATVFYDI
DGHILRISYPENDEHKAFTLGIDSRGFISNQDDEEKTIYFDPYGNWRFKKDKTTDKITVN
PEMHFCKRREYENITDLVDEILSRYLKVNAKNNDEIIVTVDDESSFNNEIIEPYKPLYII
NRHHPYSKKIGSLARAKVIVSSNEIKQNLEKNYREQFDISVIPVFNSEFRLGHSQRQNVQ
EIGFFAENANDENIHQIIQKLCNYILKNPDNYSLKIFTYNFWKADHVNKILEQIKEENKN
SFILGKSEQAENAPIDGLDDEVSLPELDVAHTRLTNISDVLSNLDKMRLLINWGKADELM
QISGVSIGIPQVQNFSSVTVVDNKNGRIIKKISELLPVVDEYLTNLNSWNQTVVYNVQLM
NQYSEENIIEKWKEVFKERKAE

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

No Significant Domain Assignments. Without architecture containing the known domains, dcGO Predictor can not do anything. 1

Jump to [ Top · Protein sequence · Domain architecture ]