dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

WP_011166677.1.32010 (NCBI 2017_08 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment copper homeostasis protein [Mycoplasma mycoides]; AA=GCF_001554055.1; RF=na; TAX=2103; STAX=2102; NAME=Mycoplasma mycoides subsp. mycoides; strain=Ben1; AL=Complete Genome; RT=Major
Sequence length 227
Sequence
MFLEVIAKDLSDIRVINNSKADRIEFCKNLEVGGLTPSLDEIILANQITLKPLHIMIRNN
SKDFFFDDYELIKQLEMISVIQKLPNVHGIVIGALNNDYTINEDFLQRVNKIKGSLKITF
NRAFDLVKDPINALNVLAKHKIDAVLTSGGTNLNTGLEVIRQLVDQNLDIQILIGGGVDK
NNIKQCLTVNNQIHLGRAARMNSSWNSDISVDEINLFKDLDREQNNE

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]