dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

WP_011277179.1.35800 (NCBI 2017_08 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment acetyl-CoA carboxylase biotin carboxyl carrier protein subunit [Sulfolobus acidocaldarius]; AA=GCF_001560195.1; RF=na; TAX=2285; STAX=2285; NAME=Sulfolobus acidocaldarius; strain=GG12-C01-15; AL=Contig; RT=Major
Sequence length 167
Sequence
MKIIKVVTDQGDSYTFATEKRDNKDLMKAEGAEFEVEYLGAGWREGEHLVKVNGEVHTVS
IINGHLVIDNETLFKVDRVIEESLGEKVSFEELFKGKEGEIVSPLQGRIVQIRVKEGDAV
NKGQPLLSIEAMKSETVISAPKGGVVKKVLIKPGQGVKKGDLLLIIE

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]