dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

WP_011278627.1.100797 (NCBI 2017_08 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment hypothetical protein [Sulfolobus acidocaldarius]; AA=GCF_001559965.1; RF=na; TAX=2285; STAX=2285; NAME=Sulfolobus acidocaldarius; strain=GG12-C01-03; AL=Contig; RT=Major
Sequence length 271
Sequence
MRERALLFFGGVAFGTAAIFVKFCSITPPYITLFRFLFAGLVLLLIGRAIRKQGNNKNSH
NNPISLRKLVLPSLFLSLHMVLFVFSVFLTTIAASTILVSTSPIFAMIFKRRVDLFVILA
ILGIVIMNLNSPFGSIVGNLMAVISALSFALYTYFLSKIQYDFFTVTPRIYIISSAFMVP
VLPFFSMGNFNLETLMAILGLVFIPTIIGHGSVIYSANKVPISLVTSAELIEPVVATLLA
FILFSQVPSLEEIVGGVLTLISLFFAFRRRD

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]