dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

WP_011311396.1.100243 (NCBI 2017_08 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment STAS/SEC14 domain-containing protein [Thiobacillus denitrificans]; AA=GCF_000012745.1; RF=representative genome; TAX=292415; STAX=36861; NAME=Thiobacillus denitrificans ATCC 25259; strain=ATCC 25259; AL=Complete Genome; RT=Major
Sequence length 122
Sequence
MISLDVDQNLIAVTVMGQFTLADYREFEEAVAHGIAFEGKVNLLFDLRDMLSYSVDVAWE
ELKFSREHKNDFGRIAILTGDEWVAWSMWVNRMFMSADIRLFDELEAAQAWVTGGELPAP
VI

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]