dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

WP_011399530.1.94453 (NCBI 2017_08 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment nitrite reductase large subunit [Hahella chejuensis]; AA=GCF_000012985.1; RF=representative genome; TAX=349521; STAX=158327; NAME=Hahella chejuensis KCTC 2396; strain=KCTC 2396; AL=Complete Genome; RT=Major
Sequence length 816
Sequence
MKEKLVVVGNGMAGMRTVEELLKIAPDKYDITVFGSEPHGNYNRIMLSPLLSGEKTLEDI
MINDMEWYKTHNITLHAGWEKRAQKVDRRNKIVYAADGTEAAYDRLLLSTGSNPFIIPVP
GKDLKGVITFRDISDVDTMLSAAKSKQHAIVIGGGLLGLEAANGLLKHGMDVTVVHNLEI
LMNRQLDGPSARFLQAALEERGMKFRMSANTSCLEGDEHGYVKAIKFDTGETLPADIVVM
AVGIRPNTELAQSCGLYCERGVVVNDTMQTFDPSIYAIGECVQHRGELFGLVAPIWDQAK
VCANHLAGYGIGIYKQKEVSTKLKVTGIDVFSAGNFLGDNDSENIVFQDPKRGVYKKVVV
KGDKIIGSVMFGDTGDGSWYFQLMRDKTNISDFRDTLLFGQHLVGDSGRQGISAVAELPD
DTEICGCNGVCKGDIVKAITDNKLFTLDDVRAATKASASCGSCTGLVEQILAVTVGGDYS
TAPSEKPLCKCTSYGHDTVRKTIVDNGLKTFHEVAAFMEWDKPDGCHVCRPAINYYLVCA
WPDQKVDDPRSRFINERVHANIQKDNTYSVVPRMWGGLTTPNELRAIADAADKYQVPCVK
VTGGQRIDLLGVKKEDLPHIWKDLNDAGMVSGHAYGKALRTVKTCVGSEYCRFGTQDSTG
MGVKLEKMTWGSWTPAKVKMAVSGCPRNCAEATIKDFGVVAVDSGWELYVGGNGGMKVRV
SDFLVKVSTMDEVMEYAGALMQMYREQGHHNERTAPWVERVGLSYVKSELVDNPEQRKAF
HARFLESQKLAQIDPWAERAAQGVEKQEFIPLTQLN

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]