dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

WP_011449704.1.85653 (NCBI 2017_08 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment GCN5-like N-acetyltransferase [Methanospirillum hungatei]; AA=GCF_000013445.1; RF=representative genome; TAX=323259; STAX=2203; NAME=Methanospirillum hungatei JF-1; strain=JF-1; AL=Complete Genome; RT=Major
Sequence length 174
Sequence
MIAHELSSHRLSLVPVTVASCTAELKENYGLSLLLDADVPGDWPPPLVTKETLHEFIGML
TDPSSCRLCAWYWILKSDGRSSRPVLIGSGGLYINEDGTCEIGYSVLEAFQCRGYATEAV
GTILDFVFSQGDFGTVYATTYPHLYPSVRVLQKNGFIPDGPGKEEGTVRFYIRK

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]