dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

WP_011612972.1.43450 (NCBI 2017_08 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment sulfite reductase, ferredoxin dependent [Trichodesmium erythraeum]; AA=GCF_000014265.1; RF=representative genome; TAX=203124; STAX=1206; NAME=Trichodesmium erythraeum IMS101; strain=IMS101; AL=Complete Genome; RT=Major
Sequence length 902
Sequence
MIIPSQISTPKEAKPSKLEGIKENSNLLREPLASQLLEDTNHFTEEAVQILKFHGSYQQH
NRDNRIKGQEKDYQMMLRTRNPGGFIPPQLFLTLNKLSNEYGNGTLRVTTRQGFQLHGVL
KKNLKKVISSIIKSMGSTLGACGDINRNVMSPPAPYKNRPEYEYAKDYANKIADLLTPQT
GAYYEIWLDGEKVISAQEASEVKVARLRNGNGTIFPNSEEPIYGTHYMPRKFKCAVTVPG
DNSIDLYTQDVSLVVITNEVGELEGFNVLAGGGLGRTHRKEETFPCLAQEIGYVTKEDIF
DFMKAIVATQRDYGDRSNRRHARMKYLLHDWGVEKFKAKLIEYFGKSIAPFKPLPEWKYL
DFLGWHEQGDGRLFLGISVENGRVKDEDSFQLKTALRKIVDLFKLPMLLTANHNIILYEI
KPQQQQAVEQILNKHGISTEKNIDPLVRYSMACPALPTCGLAITESERTLPGILGQIRLL
LDKVGLGQEHFVVRMTGCPNGCARPYMAELGFVGSAADSYQIWLGGSPNQTRLAKPYIDK
LHINNLEAELERIFIYFKQQRQPDESFGDFCNRVGIEAIRKFVTNYQSSFSMNTDINNSS
LTSINSEKNIPIVTDVTETTPDTKSQEESTSKNLENNQEVIPMNSPVTQSTNMTQTTTTS
TTISEAQPLSTHQTPKTPTFSSDTNTTISTPSTLGKQEGQPTVETTPSTSVQQEDKLTVE
TTSGQQEGQTTVEPTIPSTSGQQEGQTTVEPTIPSTSGQQEGQPTGEPTIPSTLGKQEGQ
PTVETTIPNLDKQEAQPNRESTISDNLDKQEAQPTSESTISANLDQQEAQPIGQLESSPD
KPKDTSKMRHRVSVRDEIYTKLKEESKRQGKPVVQLATEAIAEYLEKIRKNESLTTTNET
NF

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]