dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

WP_011864421.1.33760 (NCBI 2017_08 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment bifunctional proline dehydrogenase/L-glutamate gamma-semialdehyde dehydrogenase [Shewanella loihica]; AA=GCF_000016065.1; RF=representative genome; TAX=323850; STAX=359303; NAME=Shewanella loihica PV-4; strain=PV-4; AL=Complete Genome; RT=Major
Sequence length 1059
Sequence
MFKASEVLTGRYDSATLDELFTAITNNYIVDEEQYLSELIKLVPSSDDEIQRITKRAHDL
VHKVRQYDKKGLMVGIDAFLQQYSLETQEGIILMCLAEALLRIPDAATADALIDDKLSGA
KWDEHLSKSDSTLVNASTWGLMLTGKIISLDKSIDGKPSSLLNRLVNRLGEPVIRQAMLA
AMKIMGKQFVLGRTVQEALKNSTDKRKLGYTHSYDMLGEAALTMKDAQKYYQDYSNAIAA
LGAQQYDESEAPRPTISIKLSALHPRYEVANEDRTMTELYDTLIKLVSQARSLNVGVSID
AEEVDRLELSLKLFQKLYNSDAAKGWGLLGLVVQAYSKRALPVLCWITRLAKDQGDEIPV
RLVKGAYWDSELKWAQVAGEGGYPLFTRKAGTDVSYLACARYLLSDATRGAIYPQFASHN
AQTVAAITDMAGDRLYEFQRLHGMGEELYDTLLAESGVSTVRIYAPVGAHKDLLPYLVRR
LLENGANTSFVHKLVDPKTPIESLVVHPLTTLQSYKTLANNKIVQPIDIFGAERKNSKGI
NMNIISESEPFFAALDKFKDQQWSAGPIVNGETLSGETIEVKSPYDTTQIVGKVAFANNQ
AIEQALASAHNAFGSWCSTPVEVRANALQKLADLLEENREELIALCTREAGKSIQDGIDE
VREAVDFCRYYAVQAKKMMGKPELLPGPTGELNELFLQGRGVFVCISPWNFPLAIFLGQV
TAALAAGNTVVAKPAEQTSIVGYRAVQLAHEAGIPKEALQFLPGTGATVGATITADERIG
GVCFTGSTVTAKRINLTLAQRDGAIIPLIAETGGQNAMVVDSTSQPEQVVNDVVSSSFTS
AGQRCSALRVLYLQEDIADRVIDVMKGAMDELTIGNPGSVKTDVGPVIDATAKANLNAHI
DHIKQVGRLINQLELPAGTENGHFVAPTAVEIDSIKVLEKEHFGPILHVIRYKAADLPKV
IDDINSTGFGLTLGIHSRNEGHALEVADKVNVGNVYINRNQIGAVVGVQPFGGQGLSGTG
PKAGGPHYLTRFVTEKTRTNNITAIGGNATLLSLGDSEE

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]