dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

WP_012061294.1.89664 (NCBI 2017_08 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment MULTISPECIES: polysaccharide deacetylase [Sinorhizobium]; AA=GCF_000378785.1; RF=na; TAX=935558; STAX=110321; NAME=Sinorhizobium medicae WSM1115; strain=WSM1115; AL=Scaffold; RT=Major
Sequence length 251
Sequence
MLERQSRIGPLVDRLANRAIWKLARSRRLLETDVPLVSFTFDDVPDSALGAGAAVLEKYE
ARGTFYIAGGLAGQVEPDRRLITPEGCGELLARGHEIGCHTFSHRRLRDIAGLGADLDRN
DAYLKRVGVSPGASNFAFPYNAAWPSARAELRRRYRTCRAAGEAINRGAVDPMMLKGVEI
RQPEHEARALTSWIDDVVERPGWLIFFTHDIAMQPTSYGCTPETFDHLVRYAVEKGCCIL
RVDSAADRIGW

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]