dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

WP_012183618.1.76231 (NCBI 2017_08 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment menaquinol-cytochrome c reductase cytochrome b subunit [Salinispora arenicola]; AA=GCF_000378665.1; RF=na; TAX=1169175; STAX=168697; NAME=Salinispora arenicola CNH962; strain=CNH962; AL=Scaffold; RT=Major
Sequence length 536
Sequence
MKRRKFEMAAVPGNVARGVDDRFQVATPLRRLLNKVFPDHWSFLLGEIALFSFIILLLTG
VFLTFFFEPAMTEVIYNGSYAPLRGTPMSAAYASSLDISFDIRGGLIMRQMHHWSALLFM
AAIVVHMMRVFFTGAFRKPREANWIIGSLLFWVGFLAGFTGYSLPDDGLSGTGLRIASGI
MLSIPVIGSWLTSSIFNGEFPGTIIISRFYIAHVLLIPGLLLALIGAHLGLVFKQKHTQW
PGPGRTNDNVVGERMFPRYALKQGGFFMVVFGVIALMGGLLQINPIWLFGPYEAWVVSAA
SQPDWYVMFLDGSTRLMPAWEIYIPIGDGYVIPPLFWPTVVLPGLLVGMSVLYPFIEARR
LKDHRSHNLLQRPRDVPARTGLGAMAVTFYLVLALSGANDVIADKFNISLNAMTWGGRIG
LLLLPPLAYYVTYRICLGLQQHDREVLAHGVETGIIRRLPDGRFVEVHQPLHAEDGELEY
VGWVVPKKMNRLGALGPAIRGFFYPIEKPAEAPVSPGHPPVESDAEQSEITSGERR

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]