dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

WP_012224548.1.42434 (NCBI 2017_08 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment methylenetetrahydrofolate reductase [Gluconacetobacter diazotrophicus]; AA=GCF_000067045.1; RF=na; TAX=272568; STAX=33996; NAME=Gluconacetobacter diazotrophicus PA1 5; strain=PAl 5; AL=Complete Genome; RT=Major
Sequence length 247
Sequence
MTRISVELIPRDAEALLRDAAEVRQHFPLADTLNVPSLMRFPLRGWDAVPLLRPVLPRIV
PHIRAIDVDPAGPLPGVDVPGLEEVLVVQGDPPADLGHRTFPNSSESVIRRYRREAPHLR
VYAAFDPYRRAPYHELDAVARKKDAGATGFFTQPVFDPRMLDLCMEWLAGEAVFWGLSPV
IGPKSRSYWETTNHVVFPRDFEPTIEANIAFACRAIRTVRDAGGHVYLMPLRVKLERYLA
PIQQELG

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]