dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

WP_012275753.1.86919 (NCBI 2017_08 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment 5,10-methylenetetrahydrofolate reductase [Shewanella halifaxensis]; AA=GCF_000019185.1; RF=na; TAX=458817; STAX=271098; NAME=Shewanella halifaxensis HAW-EB4; strain=HAW-EB4; AL=Complete Genome; RT=Major
Sequence length 296
Sequence
MGFHHAQHATSLNQSLSELNGDINVSFEFFPPSTPEMEKLLWNSIRRLEPLNPKFVSVTY
GANSGVRDRTHGVIERIQKETDLVAAPHLTLVDASDEELKELAKHYWNSGIRDIVALRGD
LPEGSPKPTRFANDLVSLLRSVADFDISVAAYPEVHPDASNAQSDLIHLKKKIDAGANRA
ITQFFFDVESYLRFRDRCAAAGIDAEIVPGILPVTNFNQTKRFAAMTNVSIPSWLHRQFE
GLEDDPTTRQMVGANVAIDMVKVLSREGVKDFHFYTLNRAELTYAICHTLGVRPGK

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]