dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

WP_012281375.1.48650 (NCBI 2017_08 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment MULTISPECIES: hypothetical protein [Clostridia]; AA=GCF_000305935.1; RF=representative genome; TAX=1089553; STAX=85874; NAME=Thermacetogenium phaeum DSM 12270; strain=DSM 12270; AL=Complete Genome; RT=Major
Sequence length 1527
Sequence
MKQKGRRICVLALVLSLLLCGSAYAAAVLFPDIKGHWAEQTIIELAEKGVIKGYPDGTVR
PDATITRGEFIALLARNHKVDTAAAGREPPTFDDIAGHWSEKNIEALVDRGILDPADYGG
GLKPDEPITRIEIIRMLVRAIGKGEEAKQTTDNTGFADDKSIKSSDKGYVNIAIRYDLVK
GYPDNTIRPEGKTTRAEAFTLLVRQDEVLEKIRKKAEKEGEKKPPSGSSGGGSASYPRAQ
VAFELPAAAHTDTSITVTPVLKYAKTLAWSLAKEAADGSAQPLDLAEAVSGSLDKEGGTI
VFKESGSYTLTASATNYDGKTTSCSQHITVYPVVGIAFELPQHTHTDKTVSIEVATTGLG
NLDIVWSATKDGEAVAWDTAIDGDLSNEGGTITFKEKGGYGITATVTDDTGRSFSHSSSI
TVYPVASVDFELPEKAHTDTTIDLITTLSEMDGLSINWGLTRNGEVVAIGDYLEGELTNA
GGAIRFKEKGVYALTATVTDATGREYAATSETTVYPVGVAGFYLPEITHTDKVVTVKASF
ENIDAATAVWTLTRNGAPVTLGDYVEGTLTSNGGSIRFKDKGEYILAAAFTDPAGRTYGY
SLPVTVYPVPSLSFQLPATAHTDSDIKVDTTSAELDGLTVEWLVDNTYGFQDWATYVDGK
LDNDGGTIRFKHAGVYELVARTTDAAGRVFLFENGSKTEVHPVLNIRFSLPEATYPDRTI
DLRTSGNIGVLPVEWSVSKDGIAVPFDACVEGALNAQGGKIRFTQAGQYTLTASMTDALG
RTFSYTDSVAVYPIPEIQLALPQTAYVGEAAAAAVSGSDLKNLAAAWTISASGGDSKPYT
DYASGDLSNLGGSVTFKTKGDYVLTVTMTDELGRAFSQSKAITVYPIPEIQLTLPQVGYA
GETTSVSVSGNDLENLNASWTISKDGGEAKAYTDYAGGSLTNEGGSITFKAKGSYLLTVT
MTDTLGRSFARSEAITIYPIPEIQLNLPQVGYVGEAASVSVSGSELDNLTASWSISKDGG
DSKPYAEYAGGSLSNVGGNIAFKAKGGYVLTVTLTDALGRTFSQSKAVAVYPIPDMQISL
PQLTYSGEALPVTVSGNELAGLNMVWRISIDGGALAPYTQYAAGTLGNSGGEVRISTDKT
ITVKFTAVTNDENGRSFTFASNTAAIKPIAQIPFSIPSSVHVGTSFTVAMGNVSGLEGKS
ITWSLTKNGGAASYTGTLTNGGGGISIGATGTYTLMASVTNDVGRTFTHSENITVTNTAP
NKPTASATVTRTAKDGKLLVNFAVSATDPDGDAVTYEYSGQSADGYYAVGSYTVKVRAKD
TYGLYSDWTTISFTVANSEPNTPVITRTPDGNSVPPGTPVTITASSTDPDGDAITYVWEG
RPAQTSTYPLGKNTVRVKAVDAVGAESPWTAIVFFVADSTNGGGMTLTGPESVILEEGIE
GATIIEYTFTVPPVSGHSGSDYGRVRGYNKNTRQWDQLDYQTTTNGITFSRTLAPGVYTQ
LEFYYYTNHTCMYNKSNITYSVKYYFE

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]