dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

WP_012547028.1.10127 (NCBI 2017_08 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment phenylalanine--tRNA ligase subunit beta [Dictyoglomus thermophilum]; AA=GCF_000020965.1; RF=representative genome; TAX=309799; STAX=14; NAME=Dictyoglomus thermophilum H-6-12; strain=H-6-12; ATCC 35947; AL=Complete Genome; RT=Major
Sequence length 799
Sequence
MLVSYRWLMDYLEEEIPVKEVINALRNLGLYGTIQKSIGANWDKIIIGEIKSIEKHPHSE
NLLICKVDVGEKLLNIVTGAKNVFVGAKVPVALPGVEILGEVIGIREFNGIKSEGMLCSE
YELEFSEDKEGIMILPEDFKIGSTFDTYFGKGDFLIDVEVPSNRGDCLSYLGIAREISGY
FGVPLKFEFKKAQEKDDISIKDFASCEVLDFDLCPRFTLRFIKDVKIGPSPLWLRWRLER
VGLRSINNVVDITNFIMLETGQPLHAYDFDLLKGGKLIVRRAKEGEKIVLINGEEKILDN
DILVIADAERAVGIGGIMGGKDTEINDNTKNVLLEAAYFSPVNIRRSARKLGIRTDASLR
FERNVDIHRTADILDYAAEMIRLVAGGDIAKDKIDINKGLPSLTKVFLRPERVNKILGTN
LKEDEIVRILSKIGFDIKSRNPVLEIEVPSYRQDIKEEIDLIEEVARFYGYNNIPSVPLQ
KGHIVDPPLTEEIIERRIRETLPSLGLYEAINYSFMSVKDLEKAGILNTEPFNLFIQISN
PLSEENSVLRTSLLPSLLNVAQVNSNRQQKDVFVYEIGKVFYKGKDEYIEEKHLGILMTG
EAYKDPWSVPYEIRKVDFYDLKGIVETIFERIWKEEPTFKKSNFEFMHPSKQSYIAFRDE
IVGFMGEVNPWITQNLDIRERVYFAEINLDKLNFESPKPKYKPLPIYPGIRRDLALIIPE
DMPVENVEKDILETSGELLKWLRIFDLYQGEKIEKGYKSITFSLFFLAEDHTLEDKEVDE
IINKVLIKLSEKGVYLRQK

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]