dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

WP_012719828.1.42246 (NCBI 2017_08 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment MULTISPECIES: Rrf2 family transcriptional regulator [spotted fever group]; AA=GCF_000965075.1; RF=na; TAX=1359202; STAX=35792; NAME=Rickettsia parkeri str. AT#24; strain=AT#24; AL=Contig; RT=Major
Sequence length 142
Sequence
MQLTSFTDYGLRSLIYLASKPERICSVKEISEYHNISLNHLIKVIHRLAQLGYINSSKGK
GGGIKLAFSPSSMKLGDIIEKLEPNMDIVECFNKNTNSCKITNSCQFKHFIKEASEAFIK
TLNNYTLEDAMITKTIQIKDKL

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]