dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

WP_012911217.1.69553 (NCBI 2017_08 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment hypothetical protein [Pirellula staleyi]; AA=GCF_000025185.1; RF=representative genome; TAX=530564; STAX=125; NAME=Pirellula staleyi DSM 6068; strain=DSM 6068; AL=Complete Genome; RT=Major
Sequence length 311
Sequence
MRTLAWFLAAAWLAATASTVSAQTRPPVPVPRPASATISPDEQQIREGVVKFVELYNAKK
AKELAALFAPEARVVYRDGTEVNGRDEIAKSFEAGFAASPKAAISVVVDSIRFLTADVAV
EEGDSINFPDGETQTSRSRYTVLHVKRDGVWQMQAIRTVEEESLSAYGDLQPLEWLIGDW
IDEGRSENVESTFRWDVNKSFLIEEFKVVREGAVVLQGTQRIGWDPQAKQVRSWVFDSAG
GFGEASWVMVGDAWVVKAKGVMADGTSNSATRVLIPEGASRVVWSSKDRLLGSEALPDIT
VTMVRKAPAAK

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]