dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

WP_013048241.1.58668 (NCBI 2017_08 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment GTPase ObgE [Aminobacterium colombiense]; AA=GCF_000025885.1; RF=representative genome; TAX=572547; STAX=81468; NAME=Aminobacterium colombiense DSM 12261; strain=DSM 12261; AL=Complete Genome; RT=Major
Sequence length 438
Sequence
MKFVDLVRIMVRAGRGGNGCISFRREKFVPKGGPDGANGGNGGNIILKAVEGIHTLADFE
FEKKFRAEHGEPGQGQKKVGKTGKDLIILVPCGTIVYDENTGEPLADLVEPGDQVVAAKG
GRGGRGNMHFATSMRRVPRFAEKGDEGEERNLRLELKLIADVGLVGLPNAGKSSLLAAIS
NARPKIAGYPFTTLSPNLGILAVDDDRIVVADVPGLIEGAHENKGLGIYFLRHIERTRVL
IHVLDLSVGTPEDVLYQWEVICSEFKAYKESLLERPYMVVGNKIDIERGHENAPAIESFM
KARNIPYYNTSAITGEGIAEFMGNIVALCREHTRPHSEIRLFETLEHPEERAATSRRRFE
KARVVKLDDDAGFRVIHEGLEKILKRYDFEQDDALYHFARLLKKYRIEELLEKEGAKEGD
TVVIGEIEFEYQPEQVQE

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]