dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

WP_013049861.1.44054 (NCBI 2017_08 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment sulfite reductase subunit beta [Shewanella violacea]; AA=GCF_000091325.1; RF=representative genome; TAX=637905; STAX=60217; NAME=Shewanella violacea DSS12; strain=DSS12; AL=Complete Genome; RT=Major
Sequence length 577
Sequence
MSENKNAEQAEPLSINEHLKTDSNFLRGTIQEGLDTAVTGSFSEGDQQLIKFHGFYQQDD
RDLRNERKEQKLEPLYSFMLRARVAGGVCTPDQWLGVDEIASTLTSSNSIRLTTRQTFQY
HGISKRNLRALIQSLDSKALDSIAACGDVNRNVMCNPNPVESRLHEQAFYWAKKLSDNYL
PRTKAYAEIWLGDDKLATSEGDDVEPVYGKTYLPRKFKMAVAVPPDNDVDVYTNDLGFIA
VAEEGELIGFNLVAGGGMGSTHGEVQTFPRLADDFGYIKAEDTLKFAEAILKVQRDWGNR
SNRKLSRLKYTIVKYGYEVFKAEVEKRAGVKFEPKRDVVIGDRGDRYGWIKGVDNQWHLT
LFIEGGRIKDLPGQPLQTGLREIAKIHKGDFRMTSNQNLIIARVAAEDKAEIEALARSHG
LMGKLITETRGRSIACVALPTCALAMAEAERYFPDFLTKVESLQEKHGFLNQGIVIRMTG
CPNGCARPFAAEIGLVGKAPGRYNLYLGASFEGTRLNKLYRENIQEAEILSELDTLFARY
VGEREEGETFGNFTVRIGVVAAVIDAAKDFHGQSSNA

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]