dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

WP_013061506.1.91540 (NCBI 2017_08 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment peptidase M24 [Salinibacter ruber]; AA=GCF_000090405.2; RF=na; TAX=761659; STAX=146919; NAME=Salinibacter ruber M8; strain=M8; AL=Complete Genome; RT=Major
Sequence length 298
Sequence
MWSFFADLVQKVGTEQTIVVMDAEGVGKTRRHHVRPSRMVAMWGGSLAAAGLLAALLVAF
TPLRTQIPGYGTEEMKESARLNTLRVRALQDSLAAQRDYIQRLRRLITGRVEPAPPSDGA
RSESGAGGGAVATGEAGPPASEGPSGASARNAHQQPAFAPSPRSGATASAPGGLSFPLSP
PVANGFPTRGFDVATGHYGIDVAVSEGDYVRSVGDGYVVWADWAQDGGYTIAVQHAGGYL
SVYKHNKRLLKQLGDRVTAQEPVAVTGNTGAVTTGPHLHFELWQNGLAQGPDAYIAGW

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]