dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

WP_013098893.1.92861 (NCBI 2017_08 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment MULTISPECIES: tagatose-6-phosphate ketose isomerase [Proteobacteria]; AA=GCF_000755525.1; RF=na; TAX=550; STAX=550; NAME=Enterobacter cloacae; strain=ATCC 13047; AL=Scaffold; RT=Major
Sequence length 382
Sequence
MPQITPTATTGTWTEEEIRQQPASWIRSLHNIDNLRSSIDSFLTPLLRKHDLRIVLTGAG
TSAFIGDIIAPWLAGHTGKNICAVPTTDLVTNPMDYFSPAHPLLLISFARSGNSPESVAA
VELANQFVPECYHLSITCNEAGNLYQSAIDSDNACALLMPAETHDRGFAMTSSITTMMAS
CLAVFAPETINSNTFRDVADRCQAILTSLGDFRHGVFGNEPWKRIVYLGSGGLQGAARES
ALKVLELTAGKLAAFYDSPTGFRHGPKSLVDNETLVVVFISSHPYTRQYDLDLLAELRRD
RQALRVVAIAAENDPVIEAGPHILLPPSRPFIDMEQAFCFLMYAQVFALSQSLSVGNTPD
TPSASGTVNRVVQGVVIHPWQA

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]