dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

WP_013114733.1.81496 (NCBI 2017_08 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment hypothetical protein [Brachyspira murdochii]; AA=GCF_000092845.1; RF=representative genome; TAX=526224; STAX=84378; NAME=Brachyspira murdochii DSM 12563; strain=DSM 12563; AL=Complete Genome; RT=Major
Sequence length 750
Sequence
MNNSNNSIEELLNKAKESFENKDYEKAIEYIDKVIFYNGDSYDLYHNRGLAKLNLRLYEG
AIKDFDRAIELGDYNSYYERGLAKFYMAFYKEAIEDFNKVVELDKSSAASFAYNTIGLCK
YNLNEFDEALKYYNKAIETNPNLIIAYHNIALLKHSMGLDDEALSYLNKALEIDTNNIET
YLKIYSIKLGLGLEREANEYLDKIMEMYPDDLYIYDRIGNIKIDAGYMEESLEYLKKALE
INPNFIDAYYDIAFALHKLNLNDEALSYLEKALQISPNNADTYFKIFLIKRALGDYDGAL
SCLEKILEIDDTDVAIYNEIALIKIELELYEEALYYLNKALCIDNNNAEIYNTIGLVYHY
KRNYEEAIKNFNKALELNTSMDMAYYNIGLSYYEMHDYEKAIEYYNKALEINTQYSAAYI
NLGLIEHNFGNYQEAINYYKRALEINPNYSLSYYNIALAEMSLEDYDKALEDFNHALELG
YNEADIYTNIGLIYSREAIYDKAIEYYNKVLEINPNKVNAYYNIAFCLSNMDKYKEALEI
YDKVIRMYPGNFDVYYERGYTKYRVSKYEEAIRDFDIIINVNSKHYNAYYYRGCSKKYLK
NYDEAIKDFDKAIEYNPNNPDYYSEKASCYDYLNKYRESIENYDKAIELNDNDWFLYILR
AKEKFLLSKETNLENKTNDKKSFFNKIISKITSSKNYTDLEKSALNDLEKSYNLALEDEF
NLMVFKDIIKDEFTNIDLAADFCKDNNITL

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]