dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

WP_013234009.1.93079 (NCBI 2017_08 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment chemotaxis response regulator protein-glutamate methylesterase [Herbaspirillum seropedicae]; AA=GCF_000143225.1; RF=na; TAX=757424; STAX=964; NAME=Herbaspirillum seropedicae SmR1; strain=SmR1; AL=Complete Genome; RT=Major
Sequence length 359
Sequence
MKIKVLIVDDSALIRSVMREIIGSQPDMEVVGVAPDPIIARELIKQTNPDVLTLDVEMPR
MDGLDFLEKLMRLRPMPVVMVSSLTERGSEITLRALELGAIDFVTKPKISIQSGMQEYAD
MIADKIRAAAKARVRARPARSAEQAAGGGSEALPQIRNPLTSSEKLIIIGASTGGTEAIK
EFLIRMPSDCPGILITQHMPEGFTRSFAQRLNNLCKISVVESAGNERVLPGHAYIAPGHS
HLKLVRSGANYMTQLDQGPPVNRHRPSVDVLFQSAATCAGKNAVGVILTGMGKDGAQGML
EMRNAGAYNFAQDEASCVVFGMPREAIAVGAAHEVLALQAMPGRVLAWLAEHGSRALRV

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]