dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

WP_013235323.1.82484 (NCBI 2017_08 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment chemotaxis protein CheB [Herbaspirillum seropedicae]; AA=GCF_001040945.1; RF=representative genome; TAX=964; STAX=964; NAME=Herbaspirillum seropedicae; strain=Z67; AL=Complete Genome; RT=Major
Sequence length 211
Sequence
MSELPLPELAARPIEAIVIGASAGGVEALSEILPALRRGAAVATMVVLHLPRERPSLLAQ
IFADRCRQPVVEAQDKEPAQAGVIHFAPPDYHLLVDRSEDGPILAMSNDELVNYSRPAID
VLFESAADVYGPRLLGILLTGGNHDGAAGMQAIARAGGVTVVQSPQQAQVPYMPAQALAM
GNIDYVLTLQQIADLLRTLGASGLAQEKERR

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]