dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

WP_013545213.1.47293 (NCBI 2017_08 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment 50S ribosomal protein L11 [Bartonella clarridgeiae]; AA=GCF_000253015.1; RF=representative genome; TAX=696125; STAX=56426; NAME=Bartonella clarridgeiae 73; strain=73; AL=Complete Genome; RT=Major
Sequence length 142
Sequence
MAKKSVGQLKLQIPAGAATPSPPIGPALGQRGINIMEFCKAFNAATQEMEKGAPIPVIVT
YYQDKSFTFSLKTPPVSFFLKKAANLKSGSKEPGKVSVGTIPRDKIRSIAEAKMKDLNAN
DIEAAMRMVEGSARSMGLEVLG

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]