dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

WP_013566931.1.63843 (NCBI 2017_08 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment phenylalanine--tRNA ligase subunit beta [Terriglobus saanensis]; AA=GCF_000179915.2; RF=representative genome; TAX=401053; STAX=870903; NAME=Terriglobus saanensis SP1PR4; strain=SP1PR4; AL=Complete Genome; RT=Major
Sequence length 688
Sequence
MKILSSWLREFLPSLTVDDHHLAEDLTLRGIAVEGVHEVEGGHLFEMDITTNRVDAMNHY
GVAREAAAIYGIPLMKIEDDCHAATTGDGYPVRIEAEDLCGRFTAQVVRGVNVAASTGLM
AERFAQLGQKPISNVVDVTNYTWLAMGHPTHAFDLDTLEGAIVVRRAREGEKLHLLDGSE
KTLTAEDLVVADEKKALALAGVMGGWDSRVTESTKNVLVEAAWFDQAAIRASSKRHGLHT
DASHRFERGADFAAAPVANRYVVKKLVEWCGGTAEGGMTDIVVSAIEARTAKRPHIAMSA
EEVRRLLGTTLEGGLVSADDIEKYLEALGCGLRPAAIVGTYEVALPSWRLDLEREIDLIE
EVARVYGYNRFADTLPAFSGGIIALPHVEQERVLRETLRGLGWSEVIGSTFCSEADAATF
AGEKGVVAMGNPLNAEAGVLRPSLLPGAVTMLAGNLNRDVREARVFEIGAVFTGSTAEVH
EEPSLALAAYGGARATQTISERDALFFEMKGAVEGLLAKFAPVGVSYEASPLPAWMEPGR
GARVLRGGEEIAVIGELSAAIAEKRKLKQVVVLGEVRAVKLLATPLRTPLAKEPSRFQAV
DRDLSFLFSDAVRWGAIESAIRGVGAAELVSVEPLEIFRGKTVAEGEYSLLLRIVLQAAD
RTLREDEVTGIVERVTQALASLGGKQRA

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]