dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

WP_013635052.1.96862 (NCBI 2017_08 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment carnitine dehydratase [Acidiphilium multivorum]; AA=GCF_000202835.1; RF=representative genome; TAX=926570; STAX=62140; NAME=Acidiphilium multivorum AIU301; strain=AIU301; AL=Complete Genome; RT=Major
Sequence length 490
Sequence
MMRRFRQYIDGEFVDAARSFESIDPATGDAWSLMPEADAADVDRAVTAAHRALHDLSWSG
LTPTARGRLLYRLGDLLEEQAQALAELETRDTGKVIRETSAQVAYIAEYYRYFGGLADKI
EGAHLAVDKPDMEVYLRREPIGVVAAVVPWNSQLFLAAVKIGPALAAGCTVVVKASEDGP
APLLEFAQLVDQAGFPPGVVNIITGFGDPCGQRLTSHPLVSRIAFTGGPETARHVVRNSA
ENLSHVTLELGGKSPVLVFDDADLDNACNAIIAGIFAASGQSCVAGSRLLVQNSIHDTLV
SMLSERVGKIKIGDPSDPATEMGPLATARQHRKAVEVIQSSVKAGAVLTAGGKVPPGHER
GFYLEPTILQCPNNDIPCSREELFAPVLSVMRFDTEADGIAFANDTCFALAAGIFTNDLR
RAHRLIRSVKAGVVWVNTYRAISPVVPFGGFGWSGLGREGGRESVMEYTRPKAVWINSST
CPFPDPFIMR

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]