dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

WP_013741833.1.69223 (NCBI 2017_08 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment chemotaxis response regulator protein-glutamate methylesterase [Pusillimonas sp. T7-7]; AA=GCF_000209655.1; RF=na; TAX=1007105; STAX=1007105; NAME=Pusillimonas sp. T7-7; strain=T7-7; AL=Complete Genome; RT=Major
Sequence length 351
Sequence
MKKIRVLCVDDSALVRGLMTEIINSQPDMEVVASAPDPLVARELIKQHNPDVLTLDVEMP
RMDGLDFLERLMRLRPMPVVMVSSLTERNSEVTLRALELGAVDFVTKPKLGLRDGLMEYS
LLIADKIRAAAHSRPRYAAPPATTAPRKQLTHVFSGTEKLVMIGASTGGTEAIRQVLEPL
PANSPAIMITQHMPAGFTKSFVQRLDSLCAVQVHEAEDGQRVLPGHVYLAPGGIAHMKLA
RSGANYVVKLEYSDPVNRHRPSVDVLFHSAAQVAGRNAVGAILTGMGKDGAQGMLAMRQA
GAQTFAQDEASCVVFGMPREALHIGATDVAVPLSEMSARILASAGSYGHRV

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]