dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

WP_013765949.1.50710 (NCBI 2017_08 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment penicillin-binding protein 2 [Haliscomenobacter hydrossis]; AA=GCF_000212735.1; RF=representative genome; TAX=760192; STAX=2350; NAME=Haliscomenobacter hydrossis DSM 1100; strain=DSM 1100; AL=Complete Genome; RT=Major
Sequence length 628
Sequence
MDIGSNRQQVIQMVFIAAAALLLVKVFVLQVVNGEFKQQDKASGAVARYPIYPARGLIYD
RKGKLLVVNNPMYDLMVTVDAMDTSINVNRFCALVGITPDEYKKALDKDFRSGRFSRSVP
FVFKSKISAEAFARFQEALPEFPGFEIVLRNAREYPAPVAAHLLGYIREVDGEEVKTQPD
VYTPGDYIGASGLEKTYENELRGKKGIAYVLRDKLGRYAGAYRDGKDDIPVIPGKDIKTT
VDLDLQQYAEYLLSNKRAGVVAIEPSTGEILAMVTTPNYDPNELTITNNARGDVYKKLAA
DPNIPLFNRAVMAQYPPGSIHKTILALIGQQIGVWDVDRGVSCGGAYVAPGVRLGCHRHA
YCSDLRTGIQHSCNAYFVTLFRTIVDMYGYKHPNRGLDTLNYYLNKFGYGRKLGIDYPGE
QSGRFPTSEFFDRWYARDGQWKSIWIRSLGIGQGEMLCTNIQLANLAAIIANRGHFYTPH
FFKAFGDSSTTTSNRFRTKNLVGIDRKHFDPVVDGMERVTIAGTARRAFIPDIPICGKTG
TAENNSGEDHSIFFCFAPKDNPRIAIAVYAENAGFGGSVAAPVASLMIEKYLKGEIRSPQ
RKEMEKMVLKKDYIIREVALKNGKTDQP

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]