dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

WP_013777339.1.59919 (NCBI 2017_08 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment 30S ribosomal protein S5 [Tepidanaerobacter acetatoxydans]; AA=GCF_000213235.1; RF=na; TAX=1209989; STAX=499229; NAME=Tepidanaerobacter acetatoxydans Re1; strain=Re1; AL=Complete Genome; RT=Major
Sequence length 168
Sequence
MQHRNRNVEESEFVEKIVSINRVAKVVKGGKNFRFAVLVVVGNKKGKVGVGTGKAQEIPE
AIRKGIEDAKKNLIDVPILNGTIPHESIGIFGAGKVLLKPAPEGTGVIAGGPVRAVVELA
GITDIVSKSLGSANARNMVNATIVALKQLKRAEEVAKLRNKTVEEILG

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]