dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

WP_013970310.1.7288 (NCBI 2017_08 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment MULTISPECIES: zinc ABC transporter permease [Pseudomonas putida group]; AA=GCF_000764405.1; RF=na; TAX=70775; STAX=70775; NAME=Pseudomonas plecoglossicida; strain=TND35; AL=Scaffold; RT=Major
Sequence length 260
Sequence
MADFLLYALLAGLSLALVAGPLGSFVVWRRMAYFGDTLSHAALLGVALGFAMDVSPALAV
TVGCLLLAILLVTLQQRQPLASDTLLGILAPSTLSLGLVVLSFMHDVRIDLMAYLFGDLL
AISTTDLAWILGGSALVLLLLAALWRPLLAVTVHEELAMVEGLPVAGLRMALMLLIAVVI
AVAMKIVGVLLITSLLIIPAAAAQRHARSPEQMALGASLLGVTAVCGGLAMSWFKDTPAG
PSIVVCAAVLFLLSLALPKR

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]