dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

WP_013970380.1.56258 (NCBI 2017_08 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment MULTISPECIES: glutathione S-transferase [Pseudomonas putida group]; AA=GCF_000219705.1; RF=na; TAX=1042876; STAX=303; NAME=Pseudomonas putida S16; strain=S16; AL=Complete Genome; RT=Major
Sequence length 220
Sequence
MLKLHGFSVSNYYNMVKLALLEKGLPFEEITFYGGQAPQALEVSPRGKVPVLQTEHGFLS
ETSVILDYIEQTQGGKALLPADPFGQAKVRELLKEIELYIELPARTCYAESFFGMSVEPL
VKEKARADLLAGFATLKRNGRFAPYVAGEQLTLADLMFCFSVDLAYAVGKKVLNIDFLAD
FPQAKALLQLMGENPHMARIVADKEAAMPAFMEIIRSGKR

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]