dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

WP_013970618.1.71677 (NCBI 2017_08 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment MULTISPECIES: N-acetyl-gamma-glutamyl-phosphate reductase [Pseudomonas]; AA=GCF_000325725.1; RF=na; TAX=1215088; STAX=303; NAME=Pseudomonas putida HB3267; strain=PC9; AL=Complete Genome; RT=Major
Sequence length 344
Sequence
MIKVGIVGGTGYTGVELLRLLAQHPQAEVAVITSRSEAGVAVADMYPNLRGHYDGLAFSV
PDSKTLAACDVVFFATPHGVAHALAGELLAAGTKVIDLSADFRLQDAAEWGKWYGQPHGA
PELLKDAVYGLPEVNREKIRQARLIAVPGCYPTATQLGFLPLLEAGLADPSRLIADCKSG
VSGAGRGAAVGSLFCEAGESMKAYAVKGHRHLPEISQGLRLAAGKDIGLTFVPHLTPMIR
GIHATLYATVADTSVDLQALFEKRYANEPFVDVMPAGSHPETRSVRGANVCRIAVHRPQG
GDLVVVLSVIDNLVKGASGQAVQNLNILFGLDERMGLSHAGLLP

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]