dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

WP_013971572.1.1643 (NCBI 2017_08 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment MULTISPECIES: signal peptide peptidase SppA [Pseudomonas]; AA=GCF_001586765.1; RF=na; TAX=1636605; STAX=1636605; NAME=Pseudomonas sp. ABFPK; strain=ABFPK; AL=Contig; RT=Major
Sequence length 329
Sequence
MADEWKAPEAEPEEREERKSWKLLEKTLLAGVQEQRRARRWGIFFKLLTFVYLFGILILF
TPLMDMDKAASRSASHTALVEVRGVIADQEPASADNIVKSLREAFKDSKTKAVVMRINSP
GGSPVQSGYVYDEIRRLRAEYPAIKLYAVIADLGASGAYYIASAADEIYADKASLVGSIG
VTAAGYGFVGTMEKLGVERRTYTAGEHKAFLDPFSPQKPEETEFWQGVLNTTHQQFIAMV
KQGRGERLKDKEHPELFSGLVWSGEQAKELGLVDGLGSASYVAREIVGEKELVDFTVQES
ALDRFSKRVGASVAERLAMWMGFQGPQLR

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]