dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

WP_013972011.1.7435 (NCBI 2017_08 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment MULTISPECIES: glutaminase [Pseudomonas]; AA=GCF_000814065.1; RF=na; TAX=1586081; STAX=1586081; NAME=Pseudomonas sp. C5pp; strain=C5pp; AL=Contig; RT=Major
Sequence length 302
Sequence
MQTLLNEILEEVRPLIGKGKVADYIPALADVPANQLGIAVYGNDGSYYCAGDALVPFSVQ
SISKVFSLVQAIGHSGEAIWQRLGHEPSGQPFNSLVQLEFERGRPRNPFINAGALVICDI
NQSRFAAPTLSMRDFVRRLSGNPHISIDARVADSEYQFRARNAAMAYLMQSFGNFHNEVE
TVLRSYFSYCALQMNCLDLARAFCFLANDGFCKHSGEQILTRRQTQQVNSIMATSGLYDE
AGNFAYRVGLPGKSGVGGGIVAIVPGQFTVCVWSPELNAAGNSLAGMAALELLSSRIGWS
VF

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]