dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

WP_013972666.1.28354 (NCBI 2017_08 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment MULTISPECIES: NADP-dependent oxidoreductase [Pseudomonas putida group]; AA=GCF_000510325.1; RF=na; TAX=1435058; STAX=76759; NAME=Pseudomonas monteilii SB3101; strain=SB3101; AL=Complete Genome; RT=Major
Sequence length 336
Sequence
MIYRPLGHSGLQVSALTLGSMMFGEQTSTEDALRIIDKAWDQGINFIDTADVYNAGRAEE
IVGEAVARHRHDWIVASKVGFGPADGLPNRSGLSRKHIFNALDATLTRMDMDYLDIYYLH
REDHKVPLEETVQAIGDLLRQGKIRYWGVSNFRGWRIAEACHIAERLGVPRPVVSQPLYN
IVNRQAEPEQLTAAAAHGLGVVPFSPLARGVLSGKYAPGAVPDAGSRAGRQDKRIMEVEW
RQESLAIARQIQAYVEAKGVGIVEFAIAWVLNNRLVSSAIVGPRTEEQWDTYGGALAVKI
TAEDEAFIDSLVTPGHASTPGFNDVAHFVSGRITVH

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]