dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

WP_013974072.1.32670 (NCBI 2017_08 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment MULTISPECIES: alkene reductase [Pseudomonas]; AA=GCF_002113575.1; RF=na; TAX=1981711; STAX=1981711; NAME=Pseudomonas sp. B8(2017); strain=B8(2017); AL=Scaffold; RT=Major
Sequence length 349
Sequence
MTTLFDPITLGDLQLPNRIIMAPLTRCRADEGRVPNALMAEYYVQRASAGLILSEATSVS
AMGVGYPDTPGIWNDEQVRGWNNVTKAVHAAGGRIFLQLWHVGRISHPSYLNGELPVAPS
AIQPKGHVSLVRPLSDYPTPRALETEEIIDIVEAYRSGAENAKAAGFDGVEIHGANGYLL
DQFLQSSTNQRTDRYGGSLENRARLLLEVTDAAIEVWGANRVGVHLAPRADAHDMGDADR
AETFTYVARELGKRGIAFICSREKEADDSIGPLIKEAFGGPYIVNERFDKASANAALANG
KADAVAFGVPFIANPDLPARLAADAPLNEARPETFYGKGPVGYIDYPRL

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]