dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

WP_013974295.1.9402 (NCBI 2017_08 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment MULTISPECIES: 4-hydroxy-tetrahydrodipicolinate reductase [Pseudomonas]; AA=GCF_002113565.1; RF=na; TAX=1981715; STAX=1981715; NAME=Pseudomonas sp. B4(2017); strain=B4(2017); AL=Scaffold; RT=Major
Sequence length 268
Sequence
MRRIAVMGAAGRMGKTLVEAVQQQAPQAGLTAAIDRPDSSLVGADAGELAALGRIGVPIS
DDLSKVVDEFDVLIDFTHPSVTLKNLAFCRKAGKAMVIGTTGFTPEEKQQLAEAGKEIPI
VFAANFSVGVNLCLKLLDTAARVLGDDVDIEILEAHHRHKVDAPSGTALRMGEVVAQALG
RNLQEVAVYGREGQTGARERQTIGFATVRAGDVVGDHTVLFAAEGERVEITHKASSRMTF
AKGAVRAALWLDGREPGLYDMQDVLELR

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]