dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

WP_013996048.1.92583 (NCBI 2017_08 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment phenylalanine--tRNA ligase subunit beta [Zobellia galactanivorans]; AA=GCF_002211465.1; RF=na; TAX=63186; STAX=63186; NAME=Zobellia galactanivorans; strain=OII3; AL=Contig; RT=Major
Sequence length 809
Sequence
MQISYNWLKQFLKLDWDSQKTAELLTDLGLEVEGITPFESIKGGLKGIVVGHVLSCTKHP
NADKLKVTTVDIGAESPVQIVCGAPNVDKGQKVPVATVGTKLYTPEGKVWKIGKGKIRGE
ESHGMICAEDELGLGSDHEGILVLDSKLKPGTPCSEIFDVEQDEVFEIGLTPNRADAMSH
YGVARDLKAGLIQKEINKELITPSISQFNVDNRSLKLQVDVVDSKLVPRYAGITLSNLTI
KPSPKWLQNRLRAIGINPTNNVVDATNYVLHELGQPLHAFDADRIHGKKVIVKTLPAGTK
FMTLDGEERTLHEDDLMICDSEKPMCIAGVFGGINTGVTEKTNSIFLESAYFNPVSIRKT
AKRHGLNTDASFRFERGIDIENVEYALKRAALLIKEIAGGDITSDIIDFYPKRFDEHQVF
LTFRKTYSLVGQEIPQDTIKSILTSLDIKVKSVTEAGLGLSIPSYRVDVQREVDVIEEIL
RVYGYNNIDFGTKLNASTAPVSKFDDHRLQTVIGDLLASKGFYEIMTNSLTAPANAQLID
ESETDEKSVQMLNPLSNDLSIMRRSMLYTGLETVLYNNNRKKHNLKLFEFGKSYEQQDTK
YIEDKHLCLYLTGNRSESNWSREVKAIDFFYLKSIVLNILARLGITDAISEPTSNSAFSE
GLSLAVNTKEVVSFGLIKKSILKKMNLKQEVLYADFNWDNVIALAQKNSITYREIPKYPE
VKRDLALLLDDAVSFKQVYDLGRKTEKKLLKDINLFDVYVGDKLPKGKKSYAVSFTLQDS
QRTLTDKQIDRIMGKLQKTYQTELGAELR

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]