dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

WP_014010042.1.39090 (NCBI 2017_08 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment aspartate--tRNA ligase [Corynebacterium variabile]; AA=GCF_000179395.2; RF=representative genome; TAX=858619; STAX=1727; NAME=Corynebacterium variabile DSM 44702; strain=DSM 44702; AL=Complete Genome; RT=Major
Sequence length 600
Sequence
MLRTHLCGDLRSDDTGKEVTLTGWVARRRDHGGVIFIDLRDRSGLAQVVFRENEVAERAH
DLRSEYCLKVTGIVEARPEGSENPNLASGAIEVNVSDLEILNESTALPFQIEDTTGGEVG
EETRLKYRYLDLRRERQAHALRLRSKVSQAARGVLSGEDFTEIETPTLTRSTPEGARDFL
VPARLRPGSFYALPQSPQLFKQLLMVAGMERYYQIARCYRDEDFRADRQPEFTQLDVEMS
FVDQDDVIALAENILTAVWKEIGYDIQTPIPRMTYAEAMEKYGSDKPDLRFDIQITECTE
FFKDTSFRVFKAPYVGAVVMEGGASQPRRTLDAWQEWAKQRGAKGLAYILVGEDGTLTGP
VAKNITDAEREGIAAHVGAKPGDCIFFGAGEVKPSRALLGAARGEIAERLGLIKEGDWAF
TWVVDAPLFEPAADATASGDVALGHSTWTAVHHAFTSPKPEWIDSFDENPGEATAYAYDI
VCNGNEIGGGSIRIHQRDVQERVFAVMGISEEEAREKFGFLLDAFAFGAPPHGGIAFGWD
RIVSLLGGYESIRDVIAFPKSGGGVDPLTEAPAPITAQQRKEAGIDAKPKKPEAAAPAAE

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]