dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

WP_014029872.1.78061 (NCBI 2017_08 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment phenylalanine--tRNA ligase subunit beta [Acidithiobacillus ferrivorans]; AA=GCF_000214095.2; RF=representative genome; TAX=743299; STAX=160808; NAME=Acidithiobacillus ferrivorans SS3; strain=SS3; AL=Complete Genome; RT=Major
Sequence length 799
Sequence
MRVSIQWLRELLDTSWDTEEIAQRLTMGGIEVEVVEDAAPAFHGVVVAAIQSVVCHPEAD
KLRVAQVDVGDGRLRTIVCGADNLAVGQRVPLAMPGAGLPGDRDIVIAALRGIASEGMLC
AAAELGLDDGSSGLLILDADAPIGADLRDYLGLDDQVLTLGITPNRGDALSVLGVARDLC
ALGAGTLRNPLEPMAKCSWVTSGPEEGSSTPDDFPVHIATAAQSACPSYTALWIDGVPQR
LPDRLHERLRRAGQRCIHPVVDLLNLHMLETGQPLHAFDAETLQGGLSIRWAQDGEILDA
LDGRDLPLASDMLVIADRAGPVALAGVIGGRRTAVSAQTHSIVLESAFFQPKVIQGRARR
LGLQTDAAMRFERGVDFALAPRVAAAVLTRLAILGKADLRATRSHTVLGQLPEHAPITLR
RARLARILGMDYEDTVVETALTRLGLRVSEIPDGWQAISPSHRFDLHIEADLIEEVGRIY
GYERLPAHRPVGTLQPLAMARGPQPTTLRGILQARDYHEVITYSFISRQAQDVFTPDADA
PALLNPLSTDLAVMRASLWPGLMQALQFNVKRQQDRVRIFELGRVFSANDQHLVLGGCMV
GAADRESWAQPQRAADFYDLKGDVSALLTLWPQTEFSFRPLANHPALHPGQAAEIWVADQ
RVGMLGALHPTLAAECDLDKSPFFFYLDIECLDGLVNVSRFTPLSPFPALRRDMALVIPD
DILAGTVLNVMRLSASGMVKEITIFDRYQGASLMVGTYSLAFALLLQDAERTLTDADVQA
EMDRLLVAVQRLGSIGLRA

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]