dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

WP_014039495.1.67629 (NCBI 2017_08 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment MULTISPECIES: phosphoribosylaminoimidazolesuccinocarboxamide synthase [Haloarcula]; AA=GCF_000504565.1; RF=na; TAX=1417673; STAX=51589; NAME=Haloarcula hispanica N601; strain=N601; AL=Complete Genome; RT=Major
Sequence length 344
Sequence
MTSVKEFRVDEPATAEDLGRGAFVFTDDYSVFDWGKMPDRIPDKGASLCTMGAYNFQLLE
ENHVPTHYEGVRLPDSDEVLDLGEALSADAAPEEMVIELTQVPDLPFEDGRYDYDAYHGA
ADENYLIPLEIVFRNRVGVGSSLRSRTEPADHGLDYDTWPEEVVDLDEPIVEFSTKYEEQ
DRYLDREAADRIAGTASIDRLEELARAVNHIVTQQAAEADLVHEDGKIECLYYDGEIRVA
DVVGTFDENRFSYGGQQVSKEVIRQYHKRTQPEWVEAVSEAKEQADAESVADWKSLCAES
PEPLDEDVIQVARDLYCAGTNAYIGGDVFDAPSLDEAVSAAGEL

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]